« Back
Home /
Recombinant human TRAF family member-associated NF-kappa-B activator (OPCA01309)

Recombinant human TRAF family member-associated NF-kappa-B activator (OPCA01309)

Manufacturer	AVIVA Systems Biology
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins
Specific against	other
Amount	10ug
Item no.	OPCA01309
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene symbol	TANK
Alias symbols	ITRAF, TRAF2, I-TRAF,
Gene_id	10010
Peptide sequence	MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTE NYEQRIREQQEQLSLQQTIIDKLKSQLLLVNSTQD NNYGCVPLLEDSETRKNNLTLDQPQDKVISGIARE KLPKVDIASAESSI
Reconstitution and storage	Store at -20C, for extended storage, store at -80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Description of target	Recombinant human TRAF family member-associated NF-kappa-B activator
Purity	>90% (SDS-PAGE)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Delivery expected until 5/30/2024