Comparison

Recombinant Human Lysosome-associated membrane glycoprotein 2(LAMP2),partial (Active)

Item no. CSB-AP005471HU-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Conjugate/Tag HIS
Purity Greater than 95% as determined by SDS-PAGE.
Sequence LELNLTDSENATCLYAKWQMNFTVRYETTNKTYKT VTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSW IANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKG ILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHY WDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHT TVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMG LQLNITQDKVASVININPNTTHSTGSCRSHTALLR LNS
Protein Family LAMP family
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Lysosome-Associated Membrane Glycoprotein 2; LAMP-2; Lysosome-Associated Membrane Protein 2; CD107 Antigen-Like Family Member B; CD107b; LAMP2
Available
Manufacturer - Category
Other Recombinant Protein / Others
Manufacturer - Conjugate / Tag
C-terminal 6xHis-tagged
Molecular Weight
33.94 kDa
General Research Areas
Cancer
Relevance
Lysosomal Associated Membrane Protein 2 (LAMP2) is a major component of lysosomal membranes. LAMP2 is a transmembrane glycoprotein about 110kDa. Mature human LAMP2 consists of a 347 amino acid (aa) intralumenal domain, a 24 aa transmembrane segment, and a 35 aa cytoplasmic tail . The lumenal domain is organized into two heavily N-glycosylated regions. Alternate splicing generates a human LAMP2 isoform (LAMP2B) with a substituted juxtamembrane lumenal region, cytoplasmic tail and transmenmbrane segment.LAMP2 itself can cleavage lysosomal luminal domain and degradation lysosomal. In the help of chaperone HSC73, LAMP2 mediates the lysosomal uptake in complex with cargo proteins and is required for the lysosomal destruction of autophagic vacuoles.
Function
Plays an important role in chaperone-mediated autophagy, a process that mediates lysosomal degradation of proteins in response to various stresses and as part of the normal turnover of proteins with a long biological half-live
Subcellular Location
Cell membrane, Single-pass type I membrane protein, Endosome membrane, Single-pass type I membrane protein, Lysosome membrane, Single-pass type I membrane protein, Cytoplasmic vesicle, autophagosome membrane
Tissue Specificity
Isoform LAMP-2A is highly expressed in placenta, lung and liver, less in kidney and pancreas, low in brain and skeletal muscle (PubMed:7488019, PubMed:26856698). Isoform LAMP-2B is detected in spleen, thymus, prostate, testis, small intestine, colon, skeletal muscle, brain, placenta, lung, kidney, ovary and pancreas and liver (PubMed:7488019, PubMed:26856698). Isoform LAMP-2C is detected in small intestine, colon, heart, brain, skeletal muscle, and at lower levels in kidney and placenta (PubMed:26856698).
Involvement in disease
Danon disease (DAND)
Paythway
Autophagy-animal
Gene Names
LAMP2
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Storage Buffer
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.2
Expression Region
29-375aa
Protein Description
Partial
Biological Activity
The ED50 as determined by its ability to bind Human LGALS-3 in functional ELISA is less than 30 ug/ml.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close