Comparison

Recombinant Human PHD finger-like domain-containing protein 5A(PHF5A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP017915HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Splicing factor 3B-associated 14 kDa protein ; SF3b14b
AA Sequence
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDS YVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY YCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKY GFKKR
Research Topic
Transcription
Uniprot ID
Q7RTV0
Gene Names
PHF5A
Tag Info
N-terminal GST-tagged
Expression Region
1-110aa
MW of Fusion Proten
39, 4
Sequence Info
Full Length
Relevance
Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha. Also involved in pre-mRNA splicing.
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close