Comparison

Recombinant Human PHD finger-like domain-containing protein 5A(PHF5A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017915HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Transcription
Uniprot ID
Q7RTV0
Gene Names
PHF5A
Organism
Homo sapiens (Human)
AA Sequence
MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDS YVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAY YCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKY GFKKR
Expression Region
1-110aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
39.4 kDa
Alternative Name
Splicing factor 3B-associated 14KDA protein . SF3b14b
Relevance
Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha. Also involved in pre-mRNA splicing.
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved with the PAF1 complex (PAF1C) in transcriptional elongation by RNA polymerase II, and in regulation of development and maintenance of embryonic stem cell (ESC) pluripotency. Required for maintenance of ESCs self-renewal and cellular reprogramming of stem cells. Maintains pluripotency by recruiting and stabilizing PAF1C on pluripotency genes loci, and by regulating the expression of the pluripotency genes. Regulates the deposition of elongation-associated histone modifications, including dimethylated histone H3 'Lys-79' (H3K79me2) and trimethylated histone H3 'Lys-36' (H3K36me3), on PAF1C targets, self-renewal and pluripotency genes. Regulates RNA polymerase II promoter-proximal pause release of the PAF1C targets and self-renewal genes, and the levels of elongating ('Ser-2' phosphorylated) RNA polymerase II in their gene bodies. Regulates muscle specification in adult stem cells by stabilizing PAF1C in chromatin to promote myogenic differentiation (By similarity). Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex
Subcellular Location
Nucleus, Nucleus speckle
Protein Families
PHF5 family
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close