« Back
Home /
Recombinant Human Ras-related protein Rab-6A(RAB6A)

Recombinant Human Ras-related protein Rab-6A(RAB6A)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	200ug
Host	E.coli
Item no.	CSB-EP019216HU-200
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Transport
Uniprot ID	P20340
Gene Names	RAB6A
Organism	Homo sapiens (Human)
AA Sequence	STGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYD SFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAG QERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTK WIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEG ERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPG MESTQDRSREDMIDIKLEKPQEQPVSEGGCSC
Expression Region	2-208aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	39.5 kDa
Relevance	Protein transport. Regulator of mbrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity.
Reference	The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion.Zahraoui A., Touchot N., Chardin P., Tavitian A.J. Biol. Chem. 264:12394-12401(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity. Involved in COPI-independent retrograde transport from the Golgi to the ER
Subcellular Location	Golgi apparatus membrane, Lipid-anchor
Protein Families	Small GTPase superfamily, Rab family
Tissue Specificity	Ubiquitous.
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP019216HU-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200ug

available

Request delivery time