Comparison

Recombinant Human Ras-related protein Rab-6A(RAB6A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP019216HU-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
P20340
Gene Names
RAB6A
Organism
Homo sapiens (Human)
AA Sequence
STGGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYD SFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAG QERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTK WIDDVRTERGSDVIIMLVGNKTDLADKRQVSIEEG ERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPG MESTQDRSREDMIDIKLEKPQEQPVSEGGCSC
Expression Region
2-208aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
39.5 kDa
Relevance
Protein transport. Regulator of mbrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity.
Reference
The human Rab genes encode a family of GTP-binding proteins related to yeast YPT1 and SEC4 products involved in secretion.Zahraoui A., Touchot N., Chardin P., Tavitian A.J. Biol. Chem. 264:12394-12401(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER). Has a low GTPase activity. Involved in COPI-independent retrograde transport from the Golgi to the ER
Subcellular Location
Golgi apparatus membrane, Lipid-anchor
Protein Families
Small GTPase superfamily, Rab family
Tissue Specificity
Ubiquitous.
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close