Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Mouse |
Format |
Lyophilized powder |
Amount |
500ug |
Item no. |
CSB-AP004801MO-500 |
Conjugate/Tag |
Fc |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Classification |
Cytokine |
Subdivision |
Interleukin |
Research Areas |
Immunology |
Uniprot NO. |
Q60819 |
Gene Names |
Il15ra |
Source |
Mammalian cell |
Expression Region |
33-205aa |
Sequence |
GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFK RKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSL AHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKS DTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSS RAPSLAATMTLEPTASTSLRITEISPHSSKMTK |
Protein Description |
Partial |
Tag Info |
C-terminal FC-tagged |
Mol. Weight |
45.5 kDa |
Biological Activity |
The ED50 as determined by its ability to block human IL-15-induced proliferation of CTLL?2 mouse cytotoxic T cells is less than 10 ng/ml. |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Endotoxin |
Less than 1.0 EU/ug as determined by LAL method. |
Storage Buffer |
Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, pH 7.4 |
Alias |
Interleukin-15 receptor subunit alpha; Il15ra; sIL-15 receptor subunit alpha |
Relevance |
Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, or gamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with the mouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting from alternative splicing events involving different exons. |
Function |
High-affinity receptor for interleukin-15. Can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Signal transduction involves SYK (By similarity). |
Subcellular Location |
Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Soluble interleukin-15 receptor subunit alpha: Secreted, extracellular space |
Tissue Specificity |
Widely expressed. |
Tag Information |
C-terminal Fc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.