« Back
Home /
Recombinant Human Diacylglycerol O-acyltransferase 1(DGAT1),partial

Recombinant Human Diacylglycerol O-acyltransferase 1(DGAT1),partial

Item no.	CSB-CF006817HU1-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Metabolism Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIR KRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMK PFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHS CLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNI PVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFF HEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQ GNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAP AAE
Protein Family	Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Citations	"Characterization of two human genes encoding acyl coenzyme A:cholesterol acyltransferase-related enzymes." Oelkers P., Behari A., Cromley D., Billheimer J.T., Sturley S.L. J. Biol. Chem. 273:26765-26771(1998)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ACAT-related gene product 1; Acyl-CoA retinol O-fatty-acyltransferase; Short name:ARAT; Short name:; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase; AGRP1, DGAT
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	37.1 kDa
General Research Areas	Cancer
Relevance	Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Expression Region	240-488aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Subcellular Location	Endoplasmic reticulum membrane, Multi-pass membrane protein
Involvement in disease	Diarrhea 7 (DIAR7)
Gene Names	DGAT1
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF006817HU1-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 9/4/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer