Comparison

Recombinant Human Diacylglycerol O-acyltransferase 1(DGAT1),partial

Item no. CSB-CF006817HU1-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 10 ug 100 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence TVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIR KRFLLRRILEMLFFTQLQVGLIQQWMVPTIQNSMK PFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHS CLNAVAELMQFGDREFYRDWWNSESVTYFWQNWNI PVHKWCIRHFYKPMLRRGSSKWMARTGVFLASAFF HEYLVSVPLRMFRLWAFTGMMAQIPLAWFVGRFFQ GNYGNAAVWLSLIIGQPIAVLMYVHDYYVLNYEAP AAE
Protein Family Membrane-bound acyltransferase family, Sterol o-acyltransferase subfamily
Citations Characterization of two human genes encoding acyl coenzyme A:cholesterol acyltransferase-related enzymes.
Oelkers P., Behari A., Cromley D., Billheimer J.T., Sturley S.L.
J. Biol. Chem. 273:26765-26771(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias ACAT-related gene product 1; Acyl-CoA retinol O-fatty-acyltransferase; Short name:ARAT; Short name:; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase; AGRP1, DGAT
Available
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
37.1 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cancer
Relevance
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Expression Region
240-488aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders.
Subcellular Location
Endoplasmic reticulum membrane, Multi-pass membrane protein
Involvement in disease
Diarrhea 7 (DIAR7)
Gene Names
DGAT1
Sequence Info
Partial
Organism
Homo sapiens (Human)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close