« Back
Home /
Recombinant Human Diacylglycerol kinase epsilon(DGKE)

Recombinant Human Diacylglycerol kinase epsilon(DGKE)

Item no.	CSB-CF006835HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	Myc, SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVF ITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQ PTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKR FQCKEIMLKNDTKVLDAMPHHWIRGNVPLCSYCMV CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNE KCDFGEFKNLIIPPSYLTSINQMRKDKKTDYEVLA SKLGKQWTPLIILANSRSGTNMGEGLLGEFRILLN PVQ
Protein Family	Eukaryotic diacylglycerol kinase family
Citations	"Functional specialization of beta-arrestin interactions revealed by proteomic analysis." Xiao K., McClatchy D.B., Shukla A.K., Zhao Y., Chen M., Shenoy S.K., Yates J.R., Lefkowitz R.J. Proc. Natl. Acad. Sci. U.S.A. 104:12011-12016(2007)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Diglyceride kinase epsilon
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	83.9 kDa
General Research Areas	Signal Transduction
Relevance	Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition.
Expression Region	1-567aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition.
Subcellular Location	Membrane, Multi-pass membrane protein, Membrane, Cytoplasm
Tissue Specificity	Expressed predominantly in testis. Expressed in endothelium, platelets and podocytes (at protein level).
Involvement in disease	Nephrotic syndrome 7 (NPHS7); Hemolytic uremic syndrome atypical 7 (AHUS7)
Paythway	OxidativePhosphorylation
Gene Names	DGKE
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF006835HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/9/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer