« Back
Home /
Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Item no.	CSB-CF008532MO-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Food Safety Histamines Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMN STTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQ KQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFD IRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIRE ATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKC KYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVL EIQKTGKYKKVETELLT
Citations	Transcription mapping and expression analysis of candidate genes in the vicinity of the mouse Loop-tail mutation. Underhill D.A., Vogan K.J., Kibar Z., Morrison J., Rommens J., Gros P. Mamm. Genome 11:633-638(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Fc-epsilon RI-alpha
Available
Manufacturer - Targets	Fcer1a
Manufacturer - Conjugate / Tag	N-terminal 10xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.7 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Immunology
Relevance	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Biologically Active	Not Test
Expression Region	24-250aa
Protein Length	Full Length of Mature Protein
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Expressed in bone marrow mast cells, as well as in the pineal gland at night.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF008532MO-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 10/30/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer