Comparison

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

Item no. CSB-CF008532MO-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 10 ug 100 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMN STTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQ KQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFD IRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIRE ATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKC KYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVL EIQKTGKYKKVETELLT
Citations "Transcription mapping and expression analysis of candidate genes in the vicinity of the mouse Loop-tail mutation."
Underhill D.A., Vogan K.J., Kibar Z., Morrison J., Rommens J., Gros P.
Mamm. Genome 11:633-638(2000)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fc-epsilon RI-alpha
Available
Manufacturer - Targets
Fcer1a
Manufacturer - Conjugate / Tag
N-terminal 10xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
44.7 kDa
General Research Areas
Immunology
Relevance
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Expression Region
24-250aa
Protein Length
Full Length of Mature Protein
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location
Cell membrane, Single-pass type I membrane protein
Tissue Specificity
Expressed in bone marrow mast cells, as well as in the pineal gland at night.
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close