« Back
Home /
Recombinant Human Metalloendopeptidase OMA1, mitochondrial(OMA1) (Active)

Recombinant Human Metalloendopeptidase OMA1, mitochondrial(OMA1) (Active)

Item no.	CSB-CF856923HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	HVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVN KYQGLGVNQCDRWSFLPGNFHFYSTFNNKRTGGLS STKSKEIWRITSKCTVWNDAFSRQLLIKEVTAVPS LSVLHPLSPASIRAIRNFHTSPRFQAAPVPLLLMI LKPVQKLFAIIVGRGIRKWWQALPPNKKEVVKENI RKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRS KLLLLGKEQFRLLSELEYEAWMEEFKNDMLTEKDA RYL
Citations	"Inducible proteolytic inactivation of OPA1 mediated by the OMA1 protease in mammalian cells." Head B., Griparic L., Amiri M., Gandre-Babbe S., van der Bliek A.M. J. Cell Biol. 187:959-966(2009)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Metalloprotease-related protein 1
Available
Manufacturer - Targets	OMA1
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	74.7 kDa
General Research Areas	Cell Biology
Relevance	Metalloprotease that is part of the quality control system in the inner membrane of mitochondria. Following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. May also cleave UQCC3 under these conditions. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions.
Expression Region	14-524aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Biologically active	Active
Protein length	Full Length of Mature Protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF856923HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/23/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer