Comparison

Recombinant Human Metalloendopeptidase OMA1, mitochondrial(OMA1) (Active)

Item no. CSB-CF856923HU-100
Manufacturer Cusabio
Amount 100 ug
Quantity options 10 ug 100 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized powder
Specific against Human (Homo sapiens)
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence HVFFRFNSLSNWRKCNTLASTSRGCHQVQVNHIVN KYQGLGVNQCDRWSFLPGNFHFYSTFNNKRTGGLS STKSKEIWRITSKCTVWNDAFSRQLLIKEVTAVPS LSVLHPLSPASIRAIRNFHTSPRFQAAPVPLLLMI LKPVQKLFAIIVGRGIRKWWQALPPNKKEVVKENI RKNKWKLFLGLSSFGLLFVVFYFTHLEVSPITGRS KLLLLGKEQFRLLSELEYEAWMEEFKNDMLTEKDA RYL
Citations Inducible proteolytic inactivation of OPA1 mediated by the OMA1 protease in mammalian cells.
Head B., Griparic L., Amiri M., Gandre-Babbe S., van der Bliek A.M.
J. Cell Biol. 187:959-966(2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Metalloprotease-related protein 1
Available
Manufacturer - Targets
OMA1
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
74.7 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Cell Biology
Relevance
Metalloprotease that is part of the quality control system in the inner membrane of mitochondria. Following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. May also cleave UQCC3 under these conditions. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions.
Biologically Active
Active
Expression Region
14-524aa
Protein Length
Full Length of Mature Protein
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close