« Back
Home /
Recombinant Human RNA exonuclease 4(REXO4)

Recombinant Human RNA exonuclease 4(REXO4)

Item no.	CSB-CF863931HUa6-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MGKAKVPASKRAPSSPVAKPGPVKTLTRKKNKKKK RFWKSKAREVSKKPASGPGAVVRPPKAPEDFSQNW KALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQ NKKETSPQVKGEEMPAGKDQEASRGSVPSGSKMDR RAPVPRTKASGTEHNKKGTKERTNGDIVPERGDIE HKKRKAKEAAPAPPTEEDIWFDDVDPADIEAAIGP EAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALA LDC
Protein Family	REXO4 family
Citations	"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Exonuclease XPMC2; Prevents mitotic catastrophe 2 protein homolog; Short name:; hPMC2
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-B2M-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	60.7 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Expression Region	1-422aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Nucleus, nucleolus
Gene Names	REXO4
Sequence Info	Full Length
Organism	Homo sapiens(Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-CF863931HUa6-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 10/23/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer