Comparison

Recombinant Rat Basic leucine zipper transcriptional factor ATF-like 3(Batf3)

Item no. CSB-EP002572RA-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRR EKNRVAAQRSRKKQTQKSDKLHEEHESLEQENSVL RREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFV QLRPDPVASWSAHDAPDHPSFIWLGTLV
Protein Family BZIP family
Citations Isolation of an AP-1 repressor by a novel method for detecting protein-protein interactions.Aronheim A., Zandi E., Hennemann H., Elledge S.J., Karin M.Mol. Cell. Biol. 17:3094-3102(1997)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Jun dimerization protein 1 ;JDP-1
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
19.1 kDa
Relevance
AP-1 family transcription factor that controls the differentiation of CD8+ thymic conventional dendritic cells in the immune syst. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha+ classical dendritic cells (cDCs) and related CD103+ dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens .
Expression Region
1-133aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
AP-1 family transcription factor that controls the differentiation of CD8(+) thymic conventional dendritic cells in the immune system. Acts via the formation of a heterodimer with JUN family proteins that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3' and regulates expression of target genes. Required for development of CD8-alpha(+) classical dendritic cells (cDCs) and related CD103(+) dendritic cells that cross-present antigens to CD8 T-cells and produce interleukin-12 (IL12) in response to pathogens (By similarity).
Subcellular Location
Nucleus
Tissue Specificity
Ubiquitously expressed.
Gene Names
Batf3
Sequence Info
Full Length
Organism
Rattus norvegicus (Rat)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close