« Back
Home /
Recombinant Mouse CD81 antigen(Cd81),partial

Recombinant Mouse CD81 antigen(Cd81),partial

Item no.	CSB-EP004960MO-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Lymphatic System Cancer
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTF HETLNCCGSNALTTLTTTILRNSLCPSGGNILTPL LQQDCHQKIDELFSGK
Protein Family	Tetraspanin (TM4SF) family
Citations	Possible involvement of CD81 in acrosome reaction of sperm in mice.Tanigawa M., Miyamoto K., Kobayashi S., Sato M., Akutsu H., Okabe M., Mekada E., Sakakibara K., Miyado M., Umezawa A., Miyado K.Mol. Reprod. Dev. 75:150-155(2008)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1,CD81
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	36.4 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.
Expression Region	116-201aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May play an important role in the regulation of lymphoma cell growth. May be involved in the acrosome reaction.
Subcellular Location	Basolateral cell membrane, Multi-pass membrane protein
Tissue Specificity	Expressed in oocytes. Highly expressed in granulosa cells.
Gene Names	Cd81
Sequence Info	Partial
Organism	Mus musculus (Mouse)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP004960MO-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 2/12/2026

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer