Recombinant Human Transcription initiation factor IIA subunit 2(GTF2A2)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP010000HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P52657
Gene Names
GTF2A2
Organism
Homo sapiens (Human)
AA Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQ VLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDN VWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGS NTTE
Expression Region
1-109aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
39.5 kDa
Alternative Name(s)
General transcription factor IIA subunit 2
TFIIA p12 subunit
Relevance
TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
Reference
"Reconstitution of human TFIIA activity from recombinant polypeptides: a role in TFIID-mediated transcription."
Sun X., Ma D., Sheldon M., Yeung K., Reinberg D.
Genes Dev. 8:2336-2348(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close