« Back
Home /
Recombinant Human HemK methyltransferase family member 2(N6AMT1)

Recombinant Human HemK methyltransferase family member 2(N6AMT1)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP010286HU-10
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Epigenetics and Nuclear Signaling
Uniprot ID	Q9Y5N5
Gene Names	N6AMT1
Organism	Homo sapiens (Human)
AA Sequence	MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNA LEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQ ALYMCTDINPEAAACTLETARCNKVHIQPVITDLV GSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGL FYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQ ETLSVLKFTKS
Expression Region	1-186aa
Sequence Info	Full Length of Isoform 2
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	46.8 kDa
Alternative Name(s)	M.HsaHemK2P N(6)-adenine-specific DNA methyltransferase 1
Relevance	Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.
Reference	"Identification of a novel putative eukaryotic DNA-methyltransferase." Reboul J., Misseri Y., Bonnerot C., Mogensen E., Lutfalla G. Submitted (MAR-1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.
Protein Families	Eukaryotic/archaeal PrmC-related family
Tissue Specificity	Widely expressed, with highest expression in parathyroid and pituitary glands, followed by adrenal gland and kidney, and lowest expression in leukocytes and mammary gland.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time