Comparison

Recombinant Human HemK methyltransferase family member 2(N6AMT1)

Item no. CSB-EP010286HU-50
Manufacturer Cusabio
Amount 50 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNA LEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQ ALYMCTDINPEAAACTLETARCNKVHIQPVITDLV GSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGL FYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQ ETLSVLKFTKS
Protein Family Eukaryotic/archaeal PrmC-related family
Citations "Identification of a novel putative eukaryotic DNA-methyltransferase."
Reboul J., Misseri Y., Bonnerot C., Mogensen E., Lutfalla G.
Submitted (MAR-1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias M.HsaHemK2P; N(6)-adenine-specific DNA methyltransferase 1
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
46.8 kDa
General Research Areas
Epigenetics and Nuclear Signaling
Relevance
Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.
Expression Region
1-186aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.
Tissue Specificity
Widely expressed, with highest expression in parathyroid and pituitary glands, followed by adrenal gland and kidney, and lowest expression in leukocytes and mammary gland.
Gene Names
N6AMT1
Sequence Info
Full Length of Isoform 2
Organism
Homo sapiens (Human)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Delivery expected until 8/28/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close