Comparison

Recombinant Human Haptoglobin(HP)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Item no. CSB-EP010691HU(A4)-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cardiovascular
Uniprot ID
P00738
Gene Names
HP
Organism
Homo sapiens (Human)
AA Sequence
VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCK NYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEA DDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDG VYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANP VQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLIN EQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKK QLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVM PICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKY VMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPI LNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDT WYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTI AEN
Expression Region
19-406aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-B2M-tagged
MW
57.3 kDa
Alternative Name
Alternative name(s):
Zonulin
Relevance
As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an Antimicrobial; Antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway.
Reference
"Evolution of haptoglobin: comparison of complementary DNA encoding Hp alpha 1S and Hp alpha 2FS."
Brune J.L., Yang F., Barnett D.R., Bowman B.H.
Nucleic Acids Res. 12:4531-4538(1984)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 1mg
Available: In stock
Listprice: €1,675.15
Price: €1,675.15
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close