Comparison

Recombinant Human Antigen KI-67(MKI67),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP014597HU(A4)-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
RKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELS QTPGHTEELANGAADSFTSAPKQTPDSGKPLKISR RVLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLP FKRGGGKDGSVTGTKRLRCMPAPEEIVEELPASKK QRVAPRARGKSSEPVVIMKRSLRTSAKRIEPAEEL NSNDMKTNKEEHKLQDSVPENKGISLRSRRQNKTE AEQQITEVFVLAERIEINRNEKKPMKTSPEMDIQN PDDGARKPIPRDKVTENKRCLRSARQNESSQPKVA EESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKT KSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNV CVKKIRTRSHRDSEDI
Research Topic
Cell Cycle
Uniprot ID
P46013
Gene Names
MKI67
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2891-3256aa
MW of Fusion Proten
56, 6
Sequence Info
Partial
Relevance
Thought to be required for maintaining cell proliferation.
Reference
Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.Ahmad Y., Boisvert F.M., Lundberg E., Uhlen M., Lamond A.I.Mol. Cell. Proteomics 11:M111.013680.01-M111.013680.15(2012)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close