Comparison

Recombinant Human Major vault protein(MVP)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015248HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Transport
Uniprot ID
Q14764
Gene Names
MVP
Organism
Homo sapiens (Human)
AA Sequence
ATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYI RQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQG LVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLE KDITPLQVVLPNTALHLKALLDFEDKDGDKVVAGD EWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRL RARKECWDRDGKERVTGEEWLVTTVGAYLPAVFEE VLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTG EEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNY CVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQL EQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVSH QAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENE GIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELPP GVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTR VVSYRVPHNAAVQVYDYREKRARVVFGPELVSLGP EEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDV ITIETADHARLQLQLAYNWHFEVNDRKDPQETAKL FSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSA RIIRTAVFGFETSEAKGPDGMALPRPRDQAVFPQN GLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITT NSQEAAAKHEAQRLEQEARGRLERQKILDQSEAEK ARKELLELEALSMAVESTGTAKAEAESRAEAARIE GEGSVLQAKLKAQALAIETEAELQRVQKVRELELV YARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPST IRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPINL FNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQS AQAPQAPGDNHVVPVLR
Expression Region
2-893aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
115.2 kDa
Alternative Name
Lung resistance-related protein
Relevance
Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-Cytoplasmic domain transport. Down-regulates INFG-mediated STAT1 signaling and subsequent activation of JAK. Down-regulates SRC activity and signaling through MAP kinases.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. Down-regulates IFNG-mediated STAT1 signaling and subsequent activation of JAK. Down-regulates SRC activity and signaling through MAP kinases.
Subcellular Location
Cytoplasm, Nucleus, nuclear pore complex, Cytoplasm, perinuclear region
Tissue Specificity
Present in most normal tissues. Higher expression observed in epithelial cells with secretory and excretory functions, as well as in cells chronically exposed to xenobiotics, such as bronchial cells and cells lining the intestine. Overexpressed in many multidrug-resistant cancer cells.
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close