Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP016048HU-10 |
Conjugate/Tag |
Myc |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Signal Transduction |
Target / Protein |
NR1I2 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
O75469 |
AA Sequence |
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEV GGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMK RNARLRCPFRKGACEITRKTRRQCQACRLRKCLES GMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGV QGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLP GVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLK VSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMAD MSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAA FELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGF QQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFS PDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPA HRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF ATPLMQELFGITGS |
Tag Info |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Expression Region |
1-434aa |
Protein length |
Full Length |
MW |
69.8 kDa |
Alternative Name(s) |
Orphan nuclear receptor PAR1 Orphan nuclear receptor PXR Pregnane X receptor Steroid and xenobiotic receptor |
Relevance |
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes. |
References |
"The human orphan nuclear receptor PXR is activated by compounds that regulate CYP3A4 gene expression and cause drug interactions." Lehmann J.M., McKee D.D., Watson M.A., Willson T.M., Moore J.T., Kliewer S.A. J. Clin. Invest. 102:1016-1023(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes. |
Subcellular Location |
Nucleus |
Protein Families |
Nuclear hormone receptor family, NR1 subfamily |
Tissue Specificity |
Expressed in liver, colon and small intestine. |
Tag Information |
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.