Comparison

Recombinant Human Nuclear receptor subfamily 1 group I member 2 (NR1I2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Lyophilized Powder
Amount 500ug
Host E.coli
Item no. CSB-EP016048HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
O75469
Gene Names
NR1I2
Organism
Homo sapiens (Human)
AA Sequence
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEV GGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMK RNARLRCPFRKGACEITRKTRRQCQACRLRKCLES GMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGV QGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLP GVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLK VSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMAD MSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAA FELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGF QQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFS PDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPA HRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF ATPLMQELFGITGS
Expression Region
1-434aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW
69.8 kDa
Alternative Name
Orphan nuclear receptor PAR1
Orphan nuclear receptor PXR
Pregnane X receptor
Steroid and xenobiotic receptor
Relevance
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
Reference
"The human orphan nuclear receptor PXR is activated by compounds that regulate CYP3A4 gene expression and cause drug interactions."
Lehmann J.M., McKee D.D., Watson M.A., Willson T.M., Moore J.T., Kliewer S.A.
J. Clin. Invest. 102:1016-1023(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
Subcellular Location
Nucleus
Protein Families
Nuclear hormone receptor family, NR1 subfamily
Tissue Specificity
Expressed in liver, colon and small intestine.
Amount: 500ug
Available: In stock
Listprice: €1,013.82
Price: €1,013.82
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close