Comparison

Recombinant Human Nuclear receptor subfamily 2 group F member 6(NR2F6)

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against other
Format Liquid or Lyophilized powder
Amount 500ug
Host E.coli
Item no. CSB-EP016058HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research areas
Epigenetics and Nuclear Signaling
Target / Protein
NR2F6
Biologically active
Not Test
Expression system
E.coli
Species of origin
Homo sapiens (Human)
Uniprot ID
P10588
AA Sequence
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASP PGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV FTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHR NQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVA ASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLR AEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLL FSTVEWARHAPFFPELPVADQVALLRLSWSELFVL NAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMD QVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDA CGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRF GRLLLRLPALRAVPASLISQLFFMRLVGKTPIETL IRDMLLSGSTFNWPYGSGQ
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-404aa
Protein length
Full Length
MW
59 kDa
Alternative Name(s)
V-erbA-related protein 2
Short name:
EAR-2
Relevance
Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4+ T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).
References
"Identification of two novel members of erbA superfamily by molecular cloning: the gene products of the two are highly related to each other."Miyajima N., Kadowaki Y., Fukushige S., Shimizu S., Semba K., Yamanashi Y., Matsubara K., Toyoshima K., Yamamoto T.Nucleic Acids Res. 16:11057-11074(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Transcription factor predominantly involved in transcriptional repression. Binds to promoter/enhancer response elements that contain the imperfect 5'-AGGTCA-3' direct or inverted repeats with various spacings which are also recognized by other nuclear hormone receptors. Involved in modulation of hormonal responses. Represses transcriptional activity of the lutropin-choriogonadotropic hormone receptor/LHCGR gene, the renin/REN gene and the oxytocin-neurophysin/OXT gene. Represses the triiodothyronine-dependent and -independent transcriptional activity of the thyroid hormone receptor gene in a cell type-specific manner. The corepressing function towards thyroid hormone receptor beta/THRB involves at least in part the inhibition of THRB binding to triiodothyronine response elements (TREs) by NR2F6. Inhibits NFATC transcription factor DNA binding and subsequently its transcriptional activity. Acts as transcriptional repressor of IL-17 expression in Th-17 differentiated CD4(+) T cells and may be involved in induction and/or maintenance of peripheral immunological tolerance and autoimmunity. Involved in development of forebrain circadian clock; is required early in the development of the locus coeruleus (LC).
Subcellular Location
Nucleus
Protein Families
Nuclear hormone receptor family, NR2 subfamily
Tissue Specificity
Expressed in heart, placenta, liver, skeletal muscle, kidney and pancreas.
Tag Information
N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close