Comparison

Recombinant Human Oncostatin-M(OSM),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP017260HU(F)-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Short name:OSM
AA Sequence
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGF LQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNI EDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEP TKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHR FMHSVGRVFSKWGESPNRSRR
Research Topic
Immunology
Uniprot ID
P13725
Gene Names
OSM
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
26-221aa
MW of Fusion Proten
38, 2
Sequence Info
Partial
Relevance
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration
Reference
"Molecular cloning, sequence analysis, and functional expression of a novel growth regulator, oncostatin M."Malik N., Kallestad J.C., Gunderson N.L., Austin S.D., Neubauer M.G., Ochs V., Marquardt H., Zarling J.M., Shoyab M., Wei C.M., Linsley P.S., Rose T.M.Mol. Cell. Biol. 9:2847-2853(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €780.22
Price: €780.22
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close