« Back
Home /
Recombinant Human Oncostatin-M(OSM)

Recombinant Human Oncostatin-M(OSM)

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Glial Cell Markers
Type	Proteins Recombinant
Specific against	other
Amount	500ug
Host	E.coli
Item no.	CSB-EP017260HU(F)-500
eClass 6.1	34160400
eClass 9.0	42020190
Available
Target / Protein	OSM
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P13725
AA Sequence	AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYI RIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGF LQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNI EDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEP TKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHR FMHSVGRVFSKWGESPNRSRR
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	26-221aa
Protein length	Full Length of Mature Protein
MW	38.2 kDa
Alternative Name(s)	Short name:OSM
Relevance	Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration
References	"Molecular cloning, sequence analysis, and functional expression of a novel growth regulator, oncostatin M."Malik N., Kallestad J.C., Gunderson N.L., Austin S.D., Neubauer M.G., Ochs V., Marquardt H., Zarling J.M., Shoyab M., Wei C.M., Linsley P.S., Rose T.M.Mol. Cell. Biol. 9:2847-2853(1989)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration (By similarity).
Subcellular Location	Secreted
Protein Families	LIF/OSM family
Paythway	Jak-STATsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time