Comparison

Recombinant Human Glycodelin(PAEP)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP017381HU-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Tags & Cell Markers
Uniprot ID
P09466
Gene Names
PAEP
Organism
Homo sapiens (Human)
AA Sequence
MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATL KAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKK VLGEKTENPKKFKINYTVANEATLLDTDYDNFLFL CLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAF RPLPRHLWYLLDLKQMEEPCRF
Expression Region
19-180aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 10xHis-tagged
MW
22.4 kDa
Alternative Name
Placental protein 14
Short name:
PP14
Pregnancy-associated endometrial alpha-2 globulin
Short name:
PAEG
Short name:
PEG
Progestagen-associated endometrial protein
Progesterone-associated endometrial protein
Relevance
This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
Reference
"Multiple forms of mRNA encoding human pregnancy-associated endometrial alpha 2-globulin, a beta-lactoglobulin homologue."Garde J., Bell S.C., Eperon I.C.Proc. Natl. Acad. Sci. U.S.A. 88:2456-2460(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities
Subcellular Location
Secreted
Protein Families
Calycin superfamily, Lipocalin family
Tissue Specificity
This protein is, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy (PubMed:3667877). Glycodelin-A is expressed in amniotic fluid, endometrium/decidua and maternal serum (at protein level) (PubMed:3194393). Glycodelin-F is expressed in follicular fluid, luteinized granulosa cells and the oviduct (at protein level) (PubMed:12672671). Glycodelin-S is expressed in seminal plasma and seminal vesicles (at protein level) (PubMed:9239694). Glycodelin-C is detected in cumulus cells (at protein level), but cumulus cells do not synthesize Glycodelin-C but take up and convert glycodelin-A and -F vis glycan remodeling (PubMed:17192260).
Amount: 50ug
Available: In stock
Listprice: €227.63
Price: €227.63
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close