Comparison

Recombinant Human Glycodelin(PAEP)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017381HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Placental protein 14
Short name:
PP14
Pregnancy-associated endometrial alpha-2 globulin
Short name:
PAEG
Short name:
PEG
Progestagen-associated endometrial protein
Progesterone-associated endometrial protein
AA Sequence
MDIPQTKQDLELPKLAGTWHSMAMATNNISLMATL KAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKK VLGEKTENPKKFKINYTVANEATLLDTDYDNFLFL CLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAF RPLPRHLWYLLDLKQMEEPCRF
Research Topic
Tags & Cell Markers
Uniprot ID
P09466
Gene Names
PAEP
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region
19-180aa
MW of Fusion Proten
23, 9
Sequence Info
Full Length of Mature Protein
Relevance
This protein is, quantitatively, the main protein synthesized and secreted in the endometrium from mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
Reference
"Multiple forms of mRNA encoding human pregnancy-associated endometrial alpha 2-globulin, a beta-lactoglobulin homologue."Garde J., Bell S.C., Eperon I.C.Proc. Natl. Acad. Sci. U.S.A. 88:2456-2460(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €880.00
Price: €880.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close