« Back
Home /
Recombinant Human Paraneoplastic antigen Ma1(PNMA1)

Recombinant Human Paraneoplastic antigen Ma1(PNMA1)

Item no.	CSB-EP018266HUb9-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer Testicular & Prostate Cancer
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEI EETLQAAMPQVSYRMLGRMFWREENAKAALLELTG AVDYAAIPREMPGKGGVWKVLFKPPTSDAEFLERL HLFLAREGWTVQDVARVLGFQNPTPTPGPEMPAEM LNYILDNVIQPLVESIWYKRLTLFSGRDIPGPGEE TFDPWLEHTNEVLEEWQVSDVEKRRRLMESLRGPA ADVIRILKSNNPAITTAECLKALEQVFGSVESSRD AQI
Protein Family	PNMA family
Citations	"Ma1, a novel neuron- and testis-specific protein, is recognized by the serum of patients with paraneoplastic neurological disorders." Dalmau J., Gultekin S.H., Voltz R., Hoard R., DesChamps T., Balmaceda C., Batchelor T., Gerstner E., Eichen J., Frennier J., Posner J.B., Rosenfeld M.R. Brain 122:27-39(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	37KDA neuronal protein; Neuron- and testis-specific protein 1
Available
Manufacturer - Targets	PNMA1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	46.8 kDa
Relevance	Antibodies against PNMA1 are present in sera from patients suffering of paraneoplastic neurological disorders.
Expression Region	1-353aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Nucleus, nucleolus
Tissue Specificity	Testis- and brain-specific. In some cancer patients, specifically expressed by paraneoplastic tumor cells.
Biologically active	Not Test
Protein length	Full Length

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP018266HUb9-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer