Comparison

Recombinant Human Ribonuclease P protein subunit p20(POP7)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP018375HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Ribonucleases P/MRP protein subunit POP7 homolog
AA Sequence
MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPN DIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIY IHGLGLAINRAINIALQLQAGSFGSLQVAANTSTV ELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O75817
Gene Names
POP7
Tag Info
N-terminal GST-tagged
Expression Region
1-140aa
MW of Fusion Proten
42, 7
Sequence Info
Full Length
Relevance
Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.
Reference
"Autoantigenic properties of some protein subunits of catalytically active complexes of human ribonuclease P."
Jarrous N., Eder P.S., Guerrier-Takada C., Hoog C., Altman S.
RNA 4:407-417(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close