« Back
Home /
Recombinant Human POU domain, class 5, transcription factor 1(POU5F1)

Recombinant Human POU domain, class 5, transcription factor 1(POU5F1)

Manufacturer	Cusabio
Category	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer S100 Calcium Binding Protein B Markers
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	100ug
Host	E.coli
Item no.	CSB-EP018403HU-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Areas	Epigenetics and Nuclear Signaling
Uniprot ID	Q01860
Gene Names	POU5F1
Organism	Homo sapiens (Human)
AA Sequence	MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTW LSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVES NSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLF GKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE ADNNENLQEICKAETLVQARKRKRTSIENRVRGNL ENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLA PGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSN
Expression Region	1-360aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal 6xHis-B2M-tagged
MW	52.6 kDa
Alternative Name(s)	Octamer-binding protein 3
Relevance	Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
Reference	Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues. Takeda J., Seino S., Bell G.I. Nucleic Acids Res. 20:4613-4620(1992)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
Subcellular Location	Cytoplasm, Nucleus
Protein Families	POU transcription factor family, Class-5 subfamily
Tissue Specificity	Expressed in developing brain. Highest levels found in specific cell layers of the cortex, the olfactory bulb, the hippocampus and the cerebellum. Low levels of expression in adult tissues.
Paythway	Signalingpathwaysregulatingpluripotencyofstemcells
Tag Information	N-terminal 6xHis-B2M-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time