Comparison

Recombinant Human POU domain, class 5, transcription factor 1

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP018403HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Octamer-binding protein 3
AA Sequence
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTW LSFQGPPGGPGIGPGVGPGSEVWGIPPCPPPYEFC GGMAYCGPQVGVGLVPQGGLETSQPEGEAGVGVES NSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIK ALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLF GKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEE ADNNENLQEICKAETLVQARKRKRTSIENRVRGNL ENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCN RRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLA PGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSN
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q01860
Gene Names
POU5F1
Tag Info
N-terminal 6xHis-B2M-tagged
Expression Region
1-360aa
MW of Fusion Proten
52, 6
Sequence Info
Full Length
Relevance
Transcription factor that binds to the octamer motif (5'-ATTTGCAT-3'). Forms a trimeric complex with SOX2 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency.
Reference
"Human Oct3 gene family: cDNA sequences, alternative splicing, gene organization, chromosomal location, and expression at low levels in adult tissues."
Takeda J., Seino S., Bell G.I.
Nucleic Acids Res. 20:4613-4620(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close