Comparison

Recombinant Human Ras-related protein Rap-2b(RAP2B)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP019327HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MREYKVVVLGSGGVGKSALTVQFVTGSFIEKYDPT IEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL YIKNGQGFILVYSLVNQQSFQDIKPMRDQIIRVKR YERVPMILVGNKVDLEGEREVSYGEGKALAEEWSC PFMETSAKNKASVDELFAEIVRQMNYAAQPNGDEG CCSAC
Research Topic
Signal Transduction
Uniprot ID
P61225
Gene Names
RAP2B
Tag Info
N-terminal GST-tagged
Expression Region
1-183aa
MW of Fusion Proten
47, 2
Sequence Info
Full Length
Relevance
Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. Involved in EGFR and CHRM3 signaling pathways through stimulation of PLCE1. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May regulate membrane vesiculation in red blood cells.
Reference
"RAP2B: a RAS-related GTP-binding protein from platelets."
Ohmstede C.A., Farrell F.X., Reep B.R., Clemetson K.J., Lapetina E.G.
Proc. Natl. Acad. Sci. U.S.A. 87:6527-6531(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close