« Back
Home /
Recombinant Mouse Regenerating islet-derived protein 3-gamma(Reg3g)

Recombinant Mouse Regenerating islet-derived protein 3-gamma(Reg3g)

Manufacturer	Cusabio
Category	Neuroscience Neural Lineage Markers Metabolism Diabetes Neural Transcription Factors Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	10ug
Host	E.coli
Item no.	CSB-EP019549MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	O09049
Gene Names	Reg3g
Organism	Mus musculus (Mouse)
AA Sequence	EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNW YDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSG NSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYI NWETNPSSSSGNHCGTLSRASGFLKWRENYCNLEL PYVCKFKA
Expression Region	27-174aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	20.3 kDa
Alternative Name(s)	Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ; Reg III-gamma
Relevance	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury
Reference	Innate Stat3-mediated induction of the antimicrobial protein Reg3gamma is required for host defense against MRSA pneumonia.Choi S.M., McAleer J.P., Zheng M., Pociask D.A., Kaplan M.H., Qin S., Reinhart T.A., Kolls J.K.J. Exp. Med. 210:551-561(2013)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.
Subcellular Location	Secreted, Cytoplasm
Tissue Specificity	Predominantly expressed in the small intestine, including Paneth cells (at protein level). Hardly detectable in the colon (at protein level). Highly expressed in the lung epithelium during methicillin-resistant S.aureus infection (at protein level). Skin injury increases its epidermal expression. Also expressed in the pancreas.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time