Comparison

Recombinant Rat Regucalcin(Rgn)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Host E.coli
Item no. CSB-EP019630RA-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Gluconolactonase (EC:3.1.1.17)
Short name:
GNL
Senescence marker protein 30
Short name:
SMP-30
AA Sequence
MSSIKIECVLRENYRCGESPVWEEASKCLLFVDIP SKTVCRWDSISNRVQRVGVDAPVSSVALRQSGGYV ATIGTKFCALNWEDQSVFILAMVDEDKKNNRFNDG KVDPAGRYFAGTMAEETAPAVLERHQGSLYSLFPD HSVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYTV DAFDYDLPTGQISNRRTVYKMEKDEQIPDGMCIDV EGKLWVACYNGGRVIRLDPETGKRLQTVKLPVDKT TSCCFGGKDYSEMYVTCARDGMSAEGLLRQPDAGN IFKITGLGVKGIAPYSYAG
Research Topic
Others
Uniprot ID
Q03336
Gene Names
Rgn
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-299aa
MW of Fusion Proten
49, 4
Sequence Info
Full Length
Relevance
Gluconolactonase with low activity towards other sugar lactones, including gulonolactone and galactonolactone. Catalyzes a key step in ascorbic acid (vitamin C) biosynthesis. Can also hydrolyze diisopropyl phosphorofluoridate and phenylacetate (in vitro). Calcium-binding protein. Modulates Ca2+ signaling, and Ca2+-dependent cellular processes and enzyme activities.
Reference
"Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues."Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V.Nat. Commun. 3:876-876(2012)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 200ug
Available: In stock
Listprice: €968.79
Price: €968.79
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close