Comparison

Recombinant Human Regulator of G-protein signaling 2(RGS2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Liquid
Amount 100ug
Host E.coli
Item no. CSB-EP019651HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Cell growth-inhibiting gene 31 protein; G0/G1 switch regulatory protein 8
AA Sequence
MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKR TLLKDWKTRLSYFLQNSSTPGKPKTGKKSKQQAFI KPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEF CEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFI EKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQK RVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHA
Research Topic
Signal Transduction
Uniprot ID
P41220
Gene Names
RGS2
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-211aa
MW of Fusion Proten
40, 4
Sequence Info
Full Length
Relevance
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving th into their inactive GDP-bound form. May play a role in leukogenesis. Plays a role in negative feedback control pathway for adenylyl cyclase signaling. Binds EIF2B5 and blocks its activity, thereby inhibiting the translation of mRNA into protein.
Reference
A human gene encoding a putative basic helix-loop-helix phosphoprotein whose mRNA increases rapidly in cycloheximide-treated blood mononuclear cells.Siderovski D.P., Heximer S.P., Forsdyke D.R.DNA Cell Biol. 13:125-147(1994)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close