Comparison

Recombinant Pig Rhodopsin(RHO),partial

Manufacturer Cusabio
Category
Type Proteins Recombinant
Specific against Pig
Format Liquid or Lyophilized powder
Amount 100ug
Item no. CSB-EP019681PI1e0-100
Conjugate/Tag GST
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Areas
Signal Transduction
Target / Protein
RHO
Biologically Active
Not Test
Expression System
E.coli
Species of origin
Sus scrofa (Pig)
Uniprot ID
O18766
AA Sequence
MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPW
Tag Info
N-terminal GST-tagged
Expression Region
1-36aa
Protein Length
Partial
MW
31.2 kDa
Distributor Discount
50% off the list price
Alternative Name(s)
RHO1
Relevance
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling
Reference
Structural and functional protein network analyses predict novel signaling functions for rhodopsin.
Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M.
Mol. Syst. Biol. 7:551-551(2011)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Subcellular Location
Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Tag Information
N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close