Comparison

Recombinant Pig Rhodopsin(RHO),partial

Item no. CSB-EP019681PI1e0-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPW
Protein Family G-protein coupled receptor 1 family, Opsin subfamily
Citations "Structural and functional protein network analyses predict novel signaling functions for rhodopsin."
Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M.
Mol. Syst. Biol. 7:551-551(2011)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias RHO1
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
31.2 kDa
General Research Areas
Signal Transduction
Relevance
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling
Expression Region
1-36aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Subcellular Location
Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Biologically active
Not Test
Protein length
Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close