Comparison

Recombinant Rat Plasminogen activator inhibitor 1(Serpine1)

Item no. CSB-EP021081RA-10
Manufacturer Cusabio
Amount 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SPLPESHTAQQATNFGVKVFQHVVQASKDRNVVFS PYGVSSVLAMLQLTTAGKTRQQIQDAMGFNISERG TAPALRKLSKELMGSWNKNEISTADAIFVQRDLEL VQGFMPHFFKLFRTTVKQVDFSEVERARFIINDWV ERHTKGMISDLLAKGAVNELTRLVLVNALYFNGQW KTPFLEASTHQRLFHKSDGSTISVPMMAQNNKFNY TEFTTPDGHEYDILELPYHGETLSMFIAAPFEKDV PLS
Protein Family Serpin family
Citations Isolation and characterization of the rat plasminogen activator inhibitor-1 gene.Bruzdzinski C.J., Riordan-Johnson M., Nordby E.C., Suter S.M., Gelehrter T.D.J. Biol. Chem. 265:2078-2085(1990)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Endothelial plasminogen activator inhibitorSerpin E1
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
58.6 kDa
Relevance
Serine protease inhibitor. This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, protein C and matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major control point in the regulation of fibrinolysis .
Expression Region
24-402aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Serine protease inhibitor. Inhibits TMPRSS7. Is a primary inhibitor of tissue-type plasminogen activator (PLAT) and urokinase-type plasminogen activator (PLAU). As PLAT inhibitor, it is required for fibrinolysis down-regulation and is responsible for the controlled degradation of blood clots. As PLAU inhibitor, it is involved in the regulation of cell adhesion and spreading. Acts as a regulator of cell migration, independently of its role as protease inhibitor. It is required for stimulation of keratinocyte migration during cutaneous injury repair. It is involved in cellular and replicative senescence (By similarity). Plays a role in alveolar type 2 cells senescence in the lung (By similarity). Is involved in the regulation of cementogenic differentiation of periodontal ligament stem cells, and regulates odontoblast differentiation and dentin formation during odontogenesis (By similarity).
Subcellular Location
Secreted
Gene Names
Serpine1
Sequence Info
Full Length of Mature Protein
Organism
Rattus norvegicus (Rat)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close