« Back
Home /
Recombinant Human xcitatory amino acid transporter 3(SLC1A1),partial

Recombinant Human xcitatory amino acid transporter 3(SLC1A1),partial

Item no.	CSB-EP021432HU-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Food Safety Allergenes Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEK LSKKELEQMDVSSEVNIVNPFALESTILDNEDSDT KKSYVNGGFAVDKSDTISFTQTSQF
Protein Family	Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A1 subfamily
Citations	Loss-of-function mutations in the glutamate transporter SLC1A1 cause human dicarboxylic aminoaciduria.Bailey C.G., Ryan R.M., Thoeng A.D., Ng C., King K., Vanslambrouck J.M., Auray-Blais C., Vandenberg R.J., Broer S., Rasko J.E.J. Clin. Invest. 121:446-453(2011)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Excitatory amino-acid carrier 1,Neuronal and epithelial glutamate transporter,Sodium-dependent glutamate/aspartate transporter 3,Solute carrier family 1 member 1
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	37.5 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Neuroscience
Relevance	Transports L-glutamate, L- and D-aspartate and L-cystein (PubMed:21123949). Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Negatively regulated by ARL6IP5
Expression Region	430-524aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate
Subcellular Location	Cell membrane, Multi-pass membrane protein, Apical cell membrane, Multi-pass membrane protein
Tissue Specificity	Expressed in all tissues tested including liver, muscle, testis, ovary, retinoblastoma cell line, neurons and brain (in which there was dense expression in substantia nigra, red nucleus, hippocampus and in cerebral cortical layers).
Involvement in disease	Dicarboxylic aminoaciduria (DCBXA); Schizophrenia 18 (SCZD18)
Pathway	Glutamatergicsynapse
Gene Names	SLC1A1
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP021432HU-100-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 1/15/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer