Comparison

Recombinant Human xcitatory amino acid transporter 3(SLC1A1),partial

Item no. CSB-EP021432HU-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEK LSKKELEQMDVSSEVNIVNPFALESTILDNEDSDT KKSYVNGGFAVDKSDTISFTQTSQF
Protein Family Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A1 subfamily
Citations "Loss-of-function mutations in the glutamate transporter SLC1A1 cause human dicarboxylic aminoaciduria."Bailey C.G., Ryan R.M., Thoeng A.D., Ng C., King K., Vanslambrouck J.M., Auray-Blais C., Vandenberg R.J., Broer S., Rasko J.E.J. Clin. Invest. 121:446-453(2011)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Excitatory amino-acid carrier 1,Neuronal and epithelial glutamate transporter,Sodium-dependent glutamate/aspartate transporter 3,Solute carrier family 1 member 1
Available
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
37.5 kDa
Buffer
Tris-based buffer, 50% glycerol
General Research Areas
Neuroscience
Relevance
Transports L-glutamate, L- and D-aspartate and L-cystein (PubMed:21123949). Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Negatively regulated by ARL6IP5
Expression Region
430-524aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate
Subcellular Location
Cell membrane, Multi-pass membrane protein, Apical cell membrane, Multi-pass membrane protein
Tissue Specificity
Expressed in all tissues tested including liver, muscle, testis, ovary, retinoblastoma cell line, neurons and brain (in which there was dense expression in substantia nigra, red nucleus, hippocampus and in cerebral cortical layers).
Involvement in disease
Dicarboxylic aminoaciduria (DCBXA); Schizophrenia 18 (SCZD18)
Pathway
Glutamatergicsynapse
Gene Names
SLC1A1
Sequence Info
Partial
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close