« Back
Home /
Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A(TIMM17A)

Recombinant Human Mitochondrial import inner membrane translocase subunit Tim17-A(TIMM17A)

Item no.	CSB-EP023550HU-10
Manufacturer	Cusabio
Amount	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIK GFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWG GLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAA RNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQ FPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
Protein Family	Tim17/Tim22/Tim23 family
Citations	"The preprotein translocase of the inner mitochondrial membrane: evolutionary conservation of targeting and assembly of Tim17." Boemer U., Rassow J., Zufall N., Pfanner N., Meijer M., Maarse A.C. J. Mol. Biol. 262:389-395(1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Inner membrane preprotein translocase Tim17a
Available
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	45 kDa
General Research Areas	Signal Transduction
Relevance	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Expression Region	1-171aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Subcellular Location	Mitochondrion inner membrane, Multi-pass membrane protein
Gene Names	TIMM17A
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP023550HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10 ug

available

Delivery expected until 9/18/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer