Comparison

Recombinant Human Transient receptor potential cation channel subfamily A member 1(TRPA1),partial

Item no. CSB-EP025074HU-1
Manufacturer Cusabio
Amount 1 mg
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IGLAVGDIAEVQKHASLKRIAMQVELHTSLEKKLP LWFLRKVDQKSTIVYPNKPRSGGMLFHIFCFLFCT GEIRQEIPNADKSLEMEILKQKYRLKDLTFLLEKQ HELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQM EQRNSRWNTVLRAVKAKTHHLEP
Protein Family Transient receptor (TC 1.A.4) family
Citations A gain-of-function mutation in TRPA1 causes familial episodic pain syndrome.Kremeyer B., Lopera F., Cox J.J., Momin A., Rugiero F., Marsh S., Woods C.G., Jones N.G., Paterson K.J., Fricker F.R., Villegas A., Acosta N., Pineda-Trujillo N.G., Ramirez J.D., Zea J., Burley M.W., Bedoya G., Bennett D.L., Wood J.N., Ruiz-Linares A.Neuron 66:671-680(2010).
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Ankyrin-like with transmembrane domains protein 1,Transformation-sensitive protein p120
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
35.2 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Neuroscience
Relevance
Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function (PubMed:25389312, PubMed:25855297). Has a central role in the pain response to endogenous inflammatory mediators and to a diverse array of volatile irritants, such as mustard oil, cinnamaldehyde, garlic and acrolein, an irritant from tears gas and vehicule exhaust fumes (PubMed:25389312, PubMed:20547126). Is also activated by menthol (in vitro)(PubMed:25389312). Acts also as a ionotropic cannabinoid receptor by being activated by delta(9)-tetrahydrocannabinol (THC), the psychoactive component of marijuana (PubMed:25389312). May be a component for the mechanosensitive transduction channel of hair cells in inner ear, thereby participating in the perception of sounds. Probably operated by a phosphatidylinositol second messenger system (By similarity).
Expression Region
957-1119aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Receptor-activated non-selective cation channel involved in detection of pain and possibly also in cold perception and inner ear function
Subcellular Location
Cell membrane, Multi-pass membrane protein
Tissue Specificity
Expressed at very low level. Expressed at very low level in human fibroblasts and at a moderate level in liposarcoma cells.
Involvement in disease
Episodic pain syndrome, familial, 1 (FEPS1)
Gene Names
TRPA1
Sequence Info
Partial
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close