« Back
Home /
Recombinant Helicobacter pylori Glutamate--tRNA ligase 1(gltX1)

Recombinant Helicobacter pylori Glutamate--tRNA ligase 1(gltX1)

Item no.	CSB-EP308728HUV-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSLIVTRFAPSPTGYLHIGGLRTAIFNYLFARANQ GKFFLRIEDTDLSRNSIEAANAIIEAFKWVGLEYD GEILYQSKRFEIYKEYIQKLLDEDKAYYCYMSKEE LDALREEQKARKETPRYDNRYRDFKGTPPKGIEPV VRIKVPQNEVIGFNDGVKGEVKVNTNELDDFIIAR SDGTPTYNFVVTIDDALMGITDVIRGDDHLSNTPK QIVLYKALNFKIPNFFHVPMILNEEGQKLSKRHGA TNV
Protein Family	Class-I aminoacyl-tRNA synthetase family, Glutamate--tRNA ligase type 1 subfamily
Citations	The complete genome sequence of the gastric pathogen Helicobacter pylori.Tomb J.-F., White O., Kerlavage A.R., Clayton R.A., Sutton G.G., Fleischmann R.D., Ketchum K.A., Klenk H.-P., Gill S.R., Dougherty B.A., Nelson K.E., Quackenbush J., Zhou L., Kirkness E.F., Peterson S.N., Loftus B.J., Richardson D.L., Dodson R.J. , Khalak H.G., Glodek A., McKenney K., FitzGerald L.M., Lee N., Adams M.D., Hickey E.K., Berg D.E., Gocayne J.D., Utterback T.R., Peterson J.D., Kelley J.M., Cotton M.D., Weidman J.F., Fujii C., Bowman C., Watthey L., Wallin E., Hayes W.S., Borodovsky M., Karp P.D., Smith H.O., Fraser C.M., Venter J.C.Nature 388:539-547(1997)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Glutamyl-tRNA synthetase 1
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	69.4 kDa
Relevance	Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).
Expression Region	1-463aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction
Subcellular Location	Cytoplasm
Gene Names	gltX1
Sequence Info	Full Length
Organism	Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP308728HUV-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer