« Back
Home /
Recombinant Zaire ebolavirus Pre-small/secreted glycoprotein(GP)

Recombinant Zaire ebolavirus Pre-small/secreted glycoprotein(GP)

Item no.	CSB-EP350772ZAT-200
Manufacturer	Cusabio
Amount	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	IPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVG LNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAG EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRY VHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYR GTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATE DPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYV QLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKV NPE
Protein Family	Filoviruses glycoprotein family
Citations	The virion glycoproteins of Ebola viruses are encoded in two reading frames and are expressed through transcriptional editing.Sanchez A., Trappier S.G., Mahy B.W.J., Peters C.J., Nichol S.T.Proc. Natl. Acad. Sci. U.S.A. 93:3602-3607(1996)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	53.3 kDa
Relevance	sGP ses to possess an anti-inflammatory activity as it can reverse the barrier-decreasing effects of TNF alpha. Might therefore contribute to the lack of inflammatory reaction seen during infection in spite the of extensive necrosis and massive virus production. Does not se to be involved in activation of primary macrophages. Does not se to interact specifically with neutrophils .Delta-peptide does not se to be involved in activation of primary macrophages.
Expression Region	33-364aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	sGP seems to possess an anti-inflammatory activity as it can reverse the barrier-decreasing effects of TNF alpha. Might therefore contribute to the lack of inflammatory reaction seen during infection in spite the of extensive necrosis and massive virus production. Does not seem to be involved in activation of primary macrophages. Does not seem to interact specifically with neutrophils.
Subcellular Location	Small/secreted glycoprotein: Secreted, SUBCELLULAR LOCATION: Delta-peptide: Secreted
Gene Names	GP
Sequence Info	Full Length of Mature Protein
Organism	Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP350772ZAT-200-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 200 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer