Comparison

Recombinant Zaire ebolavirus Pre-small/secreted glycoprotein(GP)

Item no. CSB-EP350772ZAT-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence IPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVG LNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAG EWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRY VHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYR GTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATE DPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYV QLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKV NPE
Protein Family Filoviruses glycoprotein family
Citations The virion glycoproteins of Ebola viruses are encoded in two reading frames and are expressed through transcriptional editing.Sanchez A., Trappier S.G., Mahy B.W.J., Peters C.J., Nichol S.T.Proc. Natl. Acad. Sci. U.S.A. 93:3602-3607(1996)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-SUMO-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
53.3 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
sGP ses to possess an anti-inflammatory activity as it can reverse the barrier-decreasing effects of TNF alpha. Might therefore contribute to the lack of inflammatory reaction seen during infection in spite the of extensive necrosis and massive virus production. Does not se to be involved in activation of primary macrophages. Does not se to interact specifically with neutrophils .Delta-peptide does not se to be involved in activation of primary macrophages.
Expression Region
33-364aa
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
sGP seems to possess an anti-inflammatory activity as it can reverse the barrier-decreasing effects of TNF alpha. Might therefore contribute to the lack of inflammatory reaction seen during infection in spite the of extensive necrosis and massive virus production. Does not seem to be involved in activation of primary macrophages. Does not seem to interact specifically with neutrophils.
Subcellular Location
Small/secreted glycoprotein: Secreted, SUBCELLULAR LOCATION: Delta-peptide: Secreted
Gene Names
GP
Sequence Info
Full Length of Mature Protein
Organism
Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close