Item no. |
CSB-EP356214BRJ-10 |
Manufacturer |
Cusabio
|
Amount |
10 ug |
Quantity options |
1 mg
10 ug
100 ug
20 ug
200 ug
50 ug
500 ug
|
Category |
|
Type |
Proteins Recombinant |
Format |
Liquid |
Specific against |
other |
Host |
E.coli |
Conjugate/Tag |
SUMO, HIS |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Sequence |
AQSVPYGISQIKAPALHSQGYTGSNVKVAVIDSGI DSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAG TIAALNNSIGVLGVAPSASLYAVKVLDSTGSGQYS WIINGIEWAISNNMDVINMSLGGPTGSTALKTVVD KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTI AVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQ VRD |
Protein Family |
Peptidase S8 family |
Citations |
"Replacement of the Bacillus subtilis subtilisin structural gene with an In vitro-derived deletion mutation."Stahl M.L., Ferrari E.J. Bacteriol. 158:411-418(1984) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Available |
|
Manufacturer - Conjugate / Tag |
N-terminal 6xHis-SUMO-tagged |
Storage Conditions |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Molecular Weight |
43.7 kDa |
Relevance |
Subtilisin is an Extracellular domain alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides. |
Expression Region |
107-381aa |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides. |
Subcellular Location |
Secreted |
Gene Names |
aprE |
Sequence Info |
Full Length of Mature Protein |
Organism |
Bacillus subtilis (strain 168) |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.