« Back
Home /
Recombinant Bacillus subtilis Subtilisin E(aprE)

Recombinant Bacillus subtilis Subtilisin E(aprE)

Item no.	CSB-EP356214BRJ-20
Manufacturer	Cusabio
Amount	20 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	AQSVPYGISQIKAPALHSQGYTGSNVKVAVIDSGI DSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAG TIAALNNSIGVLGVAPSASLYAVKVLDSTGSGQYS WIINGIEWAISNNMDVINMSLGGPTGSTALKTVVD KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTI AVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP GGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQ VRD
Protein Family	Peptidase S8 family
Citations	Replacement of the Bacillus subtilis subtilisin structural gene with an In vitro-derived deletion mutation.Stahl M.L., Ferrari E.J. Bacteriol. 158:411-418(1984)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	43.7 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance	Subtilisin is an Extracellular domain alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Expression Region	107-381aa
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides.
Subcellular Location	Secreted
Gene Names	aprE
Sequence Info	Full Length of Mature Protein
Organism	Bacillus subtilis (strain 168)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP356214BRJ-20-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 20 ug

available

Delivery expected until 6/12/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Recommend by mail