Comparison

Recombinant Human cytomegalovirus 65KDA phosphoprotein(UL83),partial

Item no. CSB-EP361930HWV-200
Manufacturer Cusabio
Amount 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against other
Host E.coli
Conjugate/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence FDIDLLLQRGPQYSEHPTFTSQYRIQGKLEYRHTW DRHDEGAAQGDDDVWTSGSDSDEELVTTERKTPRV TGGGAMAGASTSAGRKRKSASSATACTSGVMTRGR LKAESTVAPEEDTDEDSDNEIHNPA
Protein Family Herpesviridae pp65 family
Citations "Cloning and physical mapping of a gene fragment coding for a 64-kilodalton major late antigen of human cytomegalovirus."Pande H., Baak S.W., Riggs A.D., Clark B.R., Shively J.E., Zaia J.A.Proc. Natl. Acad. Sci. U.S.A. 81:4965-4969(1984)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 65KDA matrix phosphoprotein; Phosphoprotein UL83; Tegument protein UL83
Available
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
18.2 kDa
General Research Areas
Microbiology
Relevance
Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes.
Expression Region
351-480
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Counteracts the host antiviral immune response when activated and phosphorylated, by preventing IRF3 from entering the nucleus. Also participates in the transactivation of viral major immediate-early genes by the recruitment of host IFI16 to the promoters pf these genes.
Subcellular Location
Virion tegument, Host nucleus, Host cytoplasm
Gene Names
UL83
Sequence Info
Partial
Organism
Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)
Storage Buffer
Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 200 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close